| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50022833 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_54409 (CHEMBL667167) |
|---|
| pH | 7±n/a |
|---|
| Kd | 300±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Taira, K; Benkovic, SJ Evaluation of the importance of hydrophobic interactions in drug binding to dihydrofolate reductase. J Med Chem31:129-37 (1988) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 17532.46 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 157 |
|---|
| Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
|---|
| BDBM50022833 |
|---|
| n/a |
|---|
| Name | BDBM50022833 |
|---|
| Synonyms: | (S)-2-{4-[(2-Amino-4-oxo-1,4,5,6,7,8-hexahydro-pteridin-6-ylmethyl)-amino]-benzoylamino}-pentanedioic acid | 2-{4-[(2-Amino-4-oxo-1,4,5,6,7,8-hexahydro-pteridin-6-ylmethyl)-amino]-benzoylamino}-pentanedioic acid | CHEMBL91866 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H23N7O6 |
|---|
| Mol. Mass. | 445.4292 |
|---|
| SMILES | Nc1nc2NCC(CNc3ccc(cc3)C(=O)N[C@@H](CCC(O)=O)C(O)=O)Nc2c(=O)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
