| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50022387 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_54903 |
|---|
| IC50 | 55000±n/a nM |
|---|
| Citation |  DeGraw, JI; Colwell, WT; Brown, VH; Sato, M; Kisliuk, RL; Gaumont, Y; Thorndike, J; Sirotnak, FM Synthesis and biological evaluation of 8-deazahomofolic acid and its tetrahydro derivative. J Med Chem31:150-3 (1988) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_LACCA | dhfR | folA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18437.08 |
|---|
| Organism: | Lactobacillus casei |
|---|
| Description: | ChEMBL_1357878 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
|
|
|
|---|
| BDBM50022387 |
|---|
| n/a |
|---|
| Name | BDBM50022387 |
|---|
| Synonyms: | 2-{4-[(2-Amino-4-hydroxy-5,6,7,8-tetrahydro-pyrido[3,2-d]pyrimidin-6-ylmethyl)-amino]-benzoylamino}-pentanedioic acid | CHEMBL36639 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H24N6O6 |
|---|
| Mol. Mass. | 444.4412 |
|---|
| SMILES | Nc1nc2CCC(CNc3ccc(cc3)C(=O)NC(CCC(O)=O)C(O)=O)Nc2c(=O)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
