Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine A2 receptor
LigandBDBM50367694
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30569
Ki 6±n/a nM
Citation Bridges AJBruns RFOrtwine DFPriebe SRSzotek DLTrivedi BK N6-[2-(3,5-dimethoxyphenyl)-2-(2-methylphenyl)ethyl]adenosine and its uronamide derivatives. Novel adenosine agonists with both high affinity and high selectivity for the adenosine A2 receptor. J Med Chem 31:1282-5 (1988) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenosine A2 receptor
Name:Adenosine A2 receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 30560
Components:This complex has 2 components.
Component 1
Name:Adenosine receptor
Synonyms:Adora2b
Type:PROTEIN
Mol. Mass.:36378.84
Organism:Rattus norvegicus
Description:ChEMBL_32934
Residue:332
Sequence:
MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA
IPFAITISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT
RARGIIAVLWVLAFGIGLTPFLGWNSKDRATSNCTEPGDGITNKSCCPVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMMVIYIKIFMVACKQLQHMELMEHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYS
FHRIISRYVLCQTDTKGGSGQAGGQSTFSLSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Adenosine receptor A2a and A3
Synonyms:ADENOSINE A2a | Adenosine A2a receptor (A2a) | Adenosine receptors A2a | Rat striatal adenosine A2a receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:45015.65
Organism:Rattus norvegicus (rat)
Description:Rat A2A receptors expressed in CHO cells.
Residue:410
Sequence:
MGSSVYITVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFA
ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGVRAKG
IIAICWVLSFAIGLTPMLGWNNCSQKDGNSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAF
VLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALC
WLPLHIINCFTFFCSTCRHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRT
HVLRRQEPFQAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSATHSGRRPNGYTLGL
GGGGSAQGSPRDVELPTQERQEGQEHPGLRGHLVQARVGASSWSSEFAPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50367694
n/a
NameBDBM50367694
Synonyms:CHEMBL603366
TypeSmall organic molecule
Emp. Form.C24H23Cl2N5O4
Mol. Mass.516.377
SMILESOC[C@H]1OC([C@H](O)[C@@H]1O)n1cnc2c(NCC(c3cccc(Cl)c3)c3cccc(Cl)c3)ncnc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: