Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50023714 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_54443 |
---|
IC50 | 56±n/a nM |
---|
Citation | Rosowsky, A; Bader, H; Cucchi, CA; Moran, RG; Kohler, W; Freisheim, JH Methotrexate analogues. 33. N delta-acyl-N alpha-(4-amino-4-deoxypteroyl)-L-ornithine derivatives: synthesis and in vitro antitumor activity. J Med Chem31:1332-7 (1988) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_MOUSE | Dhfr |
Type: | Enzyme |
Mol. Mass.: | 21608.82 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50023714 |
---|
n/a |
---|
Name | BDBM50023714 |
Synonyms: | 2-{4-[(2,4-Diamino-pteridin-6-ylmethyl)-formyl-amino]-benzoylamino}-5-(3,4-dichloro-benzoylamino)-pentanoic acid | CHEMBL405237 |
Type | Small organic molecule |
Emp. Form. | C27H25Cl2N9O5 |
Mol. Mass. | 626.451 |
SMILES | Nc1nc(N)c2nc(CN(C=O)c3ccc(cc3)C(=O)NC(CCCNC(=O)c3ccc(Cl)c(Cl)c3)C(O)=O)cnc2n1 |
Structure |
|