Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosylhomocysteinase
LigandBDBM50023879
Substrate/Competitorn/a
Meas. Tech.ChEBML_197366
IC50 65000±n/a nM
Citation Borcherding DRNarayanan SHasobe MMcKee JGKeller BTBorchardt RT Potential inhibitors of S-adenosylmethionine-dependent methyltransferases. 11. Molecular dissections of neplanocin A as potential inhibitors of S-adenosylhomocysteine hydrolase. J Med Chem 31:1729-38 (1988) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenosylhomocysteinase
Name:Adenosylhomocysteinase
Synonyms:Adenosylhomocysteinase | AdoHcyase | CUBP | Liver copper-binding protein | S-adenosyl-L-homocysteine hydrolase
Type:PROTEIN
Mol. Mass.:47687.65
Organism:Mus musculus
Description:ChEMBL_196559
Residue:432
Sequence:
MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPLKGARIAGCLHMTVET
AVLIETLVALGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYLWCIEQTLHF
KDGPLNMILDDGGDLTNLIHTKYPQLLSGIRGISEETTTGVHNLYKMMSNGILKVPAINV
NDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACKEGNIFVTTTGCVDIILGRHFEQMKDDAIVCNIG
HFDVEIDVKWLNENAVEKVNIKPQVDRYWLKNGRRIILLAEGRLVNLGCAMGHPSFVMSN
SFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMP
INGPFKPDHYRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50023879
n/a
NameBDBM50023879
Synonyms:2-[2-(6-Amino-purin-9-yl)-ethylidene]-propane-1,3-diol | CHEMBL49908
TypeSmall organic molecule
Emp. Form.C10H13N5O2
Mol. Mass.235.2425
SMILES[#7]-c1ncnc2n(-[#6]\[#6]=[#6](/[#6]-[#8])-[#6]-[#8])cnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: