Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPotassium-transporting ATPase alpha chain 1/beta chain
LigandBDBM22893
Substrate/Competitorn/a
Meas. Tech.ChEMBL_164920
IC50 40±n/a nM
Citation Sanfilippo PJUrbanski MPress JBHajos ZGShriver DAScott CK Synthesis of (aryloxy)alkylamines. 1. Novel antisecretory agents with H+K+-ATPase inhibitory activity. J Med Chem 31:1778-85 (1988) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Potassium-transporting ATPase alpha chain 1/beta chain
Name:Potassium-transporting ATPase alpha chain 1/beta chain
Synonyms:Potassium-transporting ATPase
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 71495
Components:This complex has 2 components.
Component 1
Name:Potassium-transporting ATPase
Synonyms:Gastric H(+)/K(+) ATPase subunit alpha | Potassium-transporting ATPase alpha chain 1 | Proton pump
Type:PROTEIN
Mol. Mass.:114109.05
Organism:Homo sapiens (Human)
Description:EBI_82
Residue:1035
Sequence:
MGKAENYELYSVELGPGPGGDMAAKMSKKKKAGGGGGKRKEKLENMKKEMEINDHQLSVA
ELEQKYQTSATKGLSASLAAELLLRDGPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAA
ICLIAFAIQASEGDLTTDDNLYLAIALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQA
TVIRDGDKFQINADQLVVGDLVEMKGGDRVPADIRILAAQGCKVDNSSLTGESEPQTRSP
ECTHESPLETRNIAFFSTMCLEGTVQGLVVNTGDRTIIGRIASLASGVENEKTPIAIEIE
HFVDIIAGLAILFGATFFIVAMCIGYTFLRAMVFFMAIVVAYVPEGLLATVTVCLSLTAK
RLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHLWFDNHIHTADTTEDQSGQ
TFDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMG
YRDRFPKVCEIPFNSTNKFQLSIHTLEDPRDPRHLLVMKGAPERVLERCSSILIKGQELP
LDEQWREAFQTAYLSLGGLGERVLGFCQLYLNEKDYPPGYAFDVEAMNFPSSGLCFAGLV
SMIDPPRATVPDAVLKCRTAGIRVIMVTGDHPITAKAIAASVGIISEGSETVEDIAARLR
VPVDQVNRKDARACVINGMQLKDMDPSELVEALRTHPEMVFARTSPQQKLVIVESCQRLG
AIVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIVTGVEQGRLIF
DNLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAES
DIMHLRPRNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRAQ
WEDHHLQDLQDSYGQEWTFGQRLYQQYTCYTVFFISIEVCQIADVLIRKTRRLSAFQQGF
FRNKILVIAIVFQVCIGCFLCYCPGMPNIFNFMPIRFQWWLVPLPYGILIFVYDEIRKLG
VRCCPGSWWDQELYY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Potassium-transporting ATPase
Synonyms:Gastric H(+)/K(+) ATPase subunit beta | Potassium-transporting ATPase subunit beta | Proton pump beta chain
Type:PROTEIN
Mol. Mass.:33369.83
Organism:Homo sapiens (Human)
Description:EBI_10719
Residue:291
Sequence:
MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLY
VLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGY
SPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFI
IKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPH
YSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22893
n/a
NameBDBM22893
Synonyms:CHEMBL512 | Ranitidine | ZANTAC | dimethyl[(5-{[(2-{[(E)-1-(methylamino)-2-nitroethenyl]amino}ethyl)sulfanyl]methyl}furan-2-yl)methyl]amine
TypeSmall organic molecule
Emp. Form.C13H22N4O3S
Mol. Mass.314.404
SMILESCN\C([CH-][N+]([O-])=O)=[NH+]/CCSCc1ccc(CN(C)C)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: