Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhenylethanolamine N-methyltransferase
LigandBDBM10758
Substrate/Competitorn/a
Meas. Tech.ChEBML_152563
Ki 854000±n/a nM
Citation Ye QHGrunewald GL Conformationally restricted and conformationally defined tyramine analogues as inhibitors of phenylethanolamine N-methyltransferase. J Med Chem 32:478-86 (1989) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Phenylethanolamine N-methyltransferase
Name:Phenylethanolamine N-methyltransferase
Synonyms:Noradrenaline N-methyltransferase | PNMTase
Type:Enzyme
Mol. Mass.:30916.97
Organism:Bos taurus (bovine)
Description:n/a
Residue:283
Sequence:
MSGTDRSQAAGAVPDSDPGLAAVSSAYQRFEPRAYLRNNYAPPRGDLSCPDGVGPWKLRC
LAQTFATGEVSGRTLIDIGSGPTIYQLLSACAHFEDITMTDFLEVNRQELRLWLREEPGA
FDWSVYSQHVCLIEGKGESWQEKECQLRARVKRILPIDVHRPQPLGAGGLAPLPADALVS
AFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLAVVPVREEEVR
EALVRTATRCGICARTPMPAHLQTGVDDVKGIFFTRAQKKVGV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10758
n/a
NameBDBM10758
Synonyms:14C-phenylethylamine | 2-phenylethan-1-amine | CHEMBL610 | phenylethylamine
TypeSmall organic molecule
Emp. Form.C8H11N
Mol. Mass.121.1796
SMILESNCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: