Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50017059 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_146243 (CHEMBL753435) |
---|
IC50 | 2±n/a nM |
---|
Citation | Fujimoto, RA; Boxer, J; Jackson, RH; Simke, JP; Neale, RF; Snowhill, EW; Barbaz, BJ; Williams, M; Sills, MA Synthesis, opioid receptor binding profile, and antinociceptive activity of 1-azaspiro[4.5]decan-10-yl amides. J Med Chem32:1259-65 (1989) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50017059 |
---|
n/a |
---|
Name | BDBM50017059 |
Synonyms: | 3,4-Dibromo-N-methyl-N-(1-methyl-1-aza-spiro[4.5]dec-6-yl)-benzamide | CHEMBL279065 |
Type | Small organic molecule |
Emp. Form. | C18H24Br2N2O |
Mol. Mass. | 444.204 |
SMILES | CN([C@H]1CCCC[C@@]11CCCN1C)C(=O)c1ccc(Br)c(Br)c1 |
Structure |
|