| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Muscarinic receptor M1 |
|---|
| Ligand | BDBM50018230 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_138126 |
|---|
| Ki | 26±n/a nM |
|---|
| Citation |  Leader, H; Smejkal, RM; Payne, CS; Padilla, FN; Doctor, BP; Gordon, RK; Chiang, PK Binary antidotes for organophosphate poisoning: aprophen analogues that are both antimuscarinics and carbamates. J Med Chem32:1522-8 (1989) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Muscarinic receptor M1 |
|---|
| Name: | Muscarinic receptor M1 |
|---|
| Synonyms: | Muscarinic acetylcholine receptor M1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 15022.43 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | ChEMBL_140161 |
|---|
| Residue: | 139 |
|---|
| Sequence: | ETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRTPRLLQAYS
WKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPAKQPPRSSPNTVKRPTRKG
RERAGKGQKPRGKEQLAKR
|
|
|
|---|
| BDBM50018230 |
|---|
| n/a |
|---|
| Name | BDBM50018230 |
|---|
| Synonyms: | 2-(4-Methylcarbamoyloxy-phenyl)-2-phenyl-propionic acid 2-diethylamino-ethyl ester | CHEMBL36583 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H30N2O4 |
|---|
| Mol. Mass. | 398.4953 |
|---|
| SMILES | CCN(CC)CCOC(=O)C(C)(c1ccccc1)c1ccc(OC(=O)NC)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
