Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50018230
Substrate/Competitorn/a
Meas. Tech.ChEMBL_140183
Ki 2±n/a nM
Citation Leader HSmejkal RMPayne CSPadilla FNDoctor BPGordon RKChiang PK Binary antidotes for organophosphate poisoning: aprophen analogues that are both antimuscarinics and carbamates. J Med Chem 32:1522-8 (1989) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic receptor M2 and M3
Synonyms:CHRM2 | Cholinergic, muscarinic M2
Type:Enzyme Catalytic Domain
Mol. Mass.:51555.53
Organism:RAT
Description:P10980
Residue:466
Sequence:
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI
VKPNNNNMPGGDGGLEHNKIQNGKAPRDGVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSRDDNSKQTCIKIVTKAQKGDVCTPTSTTVELVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50018230
n/a
NameBDBM50018230
Synonyms:2-(4-Methylcarbamoyloxy-phenyl)-2-phenyl-propionic acid 2-diethylamino-ethyl ester | CHEMBL36583
TypeSmall organic molecule
Emp. Form.C23H30N2O4
Mol. Mass.398.4953
SMILESCCN(CC)CCOC(=O)C(C)(c1ccccc1)c1ccc(OC(=O)NC)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: