Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50017232 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_201290 |
---|
Ki | 2.3±n/a nM |
---|
Citation | Hutchison, AJ; de Jesus, R; Williams, M; Simke, JP; Neale, RF; Jackson, RH; Ambrose, F; Barbaz, BJ; Sills, MA Benzofuro[2,3-c]pyridin-6-ols: synthesis, affinity for opioid-receptor subtypes, and antinociceptive activity. J Med Chem32:2221-6 (1989) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor, sigma 1 | Oprs1 | SGMR1_MOUSE | Sigma 1-type opioid receptor | Sigma1-receptor | Sigma1R | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25246.51 |
Organism: | Mus musculus (Mouse) |
Description: | O55242 |
Residue: | 223 |
Sequence: | MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPS
TLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS
|
|
|
BDBM50017232 |
---|
n/a |
---|
Name | BDBM50017232 |
Synonyms: | 3-Cyclopropylmethyl-5-ethyl-8-hydroxy-11-methyl-3,4,5,6-tetrahydro-2H-2,6-methano-benzo[d]azocin-1-one | CHEMBL71301 |
Type | Small organic molecule |
Emp. Form. | C19H25NO2 |
Mol. Mass. | 299.4073 |
SMILES | CCC1CN(CC2CC2)C2C(C)C1c1cc(O)ccc1C2=O |TLB:11:10:20.13.19:4.2.3| |
Structure |
|