Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine transporter
LigandBDBM22416
Substrate/Competitorn/a
Meas. Tech.ChEMBL_131453
Ki 0.440000±n/a nM
Citation Maryanoff BEVaught JLShank RPMcComsey DFCostanzo MJNortey SO Pyrroloisoquinoline antidepressants. 3. A focus on serotonin. J Med Chem 33:2793-7 (1990) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dopamine transporter
Name:Dopamine transporter
Synonyms:DA transporter | DAT | Sodium-dependent dopamine transporter | Solute carrier family 6 member 3
Type:Enzyme Catalytic Domain
Mol. Mass.:68809.06
Organism:MOUSE
Description:Dopamine Transporter SLC6A3 MOUSE::Q61327
Residue:619
Sequence:
MSKSKCSVGPMSSVVAPAKEPNAVGPREVELILVKEQNGVQLTNSTLINPPQTPVEVQER
ETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHC
NNTWNSPNCSDAHSSNSSDGLGLNDTFGTTPAAEYFERGVLHLHQSRGIDDLGPPRWQLT
ACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAMDGIRAYLSVD
FYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLTSFSSG
FVVFSFLGYMAQKHNVPIRDVATDGPGLIFIIYPEAIATLPLSSAWAAVFFLMLLTLGID
SAMGGMESVITGLVDEFQLLHRHRELFTLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAG
TSILFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRPNLYWRLCWKLVSPCFLLYVVVVSIV
TFRPPHYGAYIFPDWANALGWIIATSSMAMVPIYATYKFCSLPGSFREKLAYAITPEKDR
QLVDRGEVRQFTLRHWLLV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22416
n/a
NameBDBM22416
Synonyms:(3S,4R)-3-[(1,3-benzodioxol-5-yloxy)methyl]-4-(4-fluorophenyl)piperidine | (3S,4R)-3-[(2H-1,3-benzodioxol-5-yloxy)methyl]-4-(4-fluorophenyl)piperidine | CHEMBL490 | PAROXETINE | [3H]Paroxetine
Typeradiolabeled ligand
Emp. Form.C19H20FNO3
Mol. Mass.329.3654
SMILESFc1ccc(cc1)[C@@H]1CCNC[C@H]1COc1ccc2OCOc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: