Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine transporter
LigandBDBM50021879
Substrate/Competitorn/a
Meas. Tech.ChEMBL_131451
Ki 0.990000±n/a nM
Citation Maryanoff BEVaught JLShank RPMcComsey DFCostanzo MJNortey SO Pyrroloisoquinoline antidepressants. 3. A focus on serotonin. J Med Chem 33:2793-7 (1990) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dopamine transporter
Name:Dopamine transporter
Synonyms:DA transporter | DAT | Sodium-dependent dopamine transporter | Solute carrier family 6 member 3
Type:Enzyme Catalytic Domain
Mol. Mass.:68809.06
Organism:MOUSE
Description:Dopamine Transporter SLC6A3 MOUSE::Q61327
Residue:619
Sequence:
MSKSKCSVGPMSSVVAPAKEPNAVGPREVELILVKEQNGVQLTNSTLINPPQTPVEVQER
ETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHC
NNTWNSPNCSDAHSSNSSDGLGLNDTFGTTPAAEYFERGVLHLHQSRGIDDLGPPRWQLT
ACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAMDGIRAYLSVD
FYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLTSFSSG
FVVFSFLGYMAQKHNVPIRDVATDGPGLIFIIYPEAIATLPLSSAWAAVFFLMLLTLGID
SAMGGMESVITGLVDEFQLLHRHRELFTLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAG
TSILFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRPNLYWRLCWKLVSPCFLLYVVVVSIV
TFRPPHYGAYIFPDWANALGWIIATSSMAMVPIYATYKFCSLPGSFREKLAYAITPEKDR
QLVDRGEVRQFTLRHWLLV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50021879
n/a
NameBDBM50021879
Synonyms:6-(4-Chloro-phenyl)-1,2,3,5,6,10b-hexahydro-pyrrolo[2,1-a]isoquinoline;HBr | CHEMBL285506
TypeSmall organic molecule
Emp. Form.C18H18ClN
Mol. Mass.283.795
SMILESClc1ccc(cc1)[C@@H]1CN2CCC[C@@H]2c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: