Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50014005
Substrate/Competitorn/a
Meas. Tech.ChEBML_155157
Ki 15±n/a nM
Citation Sunkel CEde Casa-Juana MFSantos LGómez MMVillarroya MGonzález-Morales MAPriego JGOrtega MP 4-Alkyl-1,4-dihydropyridines derivatives as specific PAF-acether antagonists. J Med Chem 33:3205-10 (1991) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF-R | Platelet-activating factor receptor
Type:Protein
Mol. Mass.:39005.63
Organism:Cavia porcellus
Description:n/a
Residue:342
Sequence:
MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT
VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK
YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG
SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV
FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50014005
n/a
NameBDBM50014005
Synonyms:2,4,6-Trimethyl-1,4-dihydro-pyridine-3,5-dicarboxylic acid 3-methyl ester 5-(2-phenylsulfanyl-ethyl) ester | CHEMBL107881
TypeSmall organic molecule
Emp. Form.C19H23NO4S
Mol. Mass.361.455
SMILESCOC(=O)C1C(C)C(C(=O)OCCSc2ccccc2)=C(C)N=C1C |c:23,t:20|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: