Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPolyamine oxidase
LigandBDBM50015357
Substrate/Competitorn/a
Meas. Tech.ChEBML_159845
Ki 3000±n/a nM
Citation Edwards MLPrakash NJStemerick DMSunkara SPBitonti AJDavis GFDumont JABey P Polyamine analogues with antitumor activity. J Med Chem 33:1369-75 (1990) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Polyamine oxidase
Name:Polyamine oxidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:55429.08
Organism:Mus musculus
Description:ChEMBL_159845
Residue:504
Sequence:
MAFPGPRVLVVGSGIAGLGAAQKLCSHRAAPHLRVLEATASAGGRIRSERCFGGVVELGA
HWIHGPSQDNPVFQLAAEFGLLGEKELSEENQLVDTGGHVALPSMIWSSSGTSVSLELMT
EMARLFYGLIERTREFLNESETPMASVGEFLKKEISQQVASWTEDDEDTRKRKLAILNTF
FNIECCVSGTHSMDLVALAPFGEYTVLPGLDCILAGGYQGLTDRILASLPKDTVAFDKPV
KTIHWNGSFQEAAFPGETFPVLVECEDGARLPAHHVIVTVPLGFLKEHQDTFFEPPLPAK
KAEAIKKLGFGTNNKIFLEFEEPFWEPDCQFIQVVWEDTSPLQDTALSLQDTWFKKLIGF
LVQPSFESSHVLCGFIAGLESEFMETLSDEEVLLSLTQVLRRVTGNPQLPAAKSVRRSQW
HSAPYTRGSYSYVAVGSTGDDLDLMAQPLPEDGTGTQLQVLFAGEATHRTFYSTTHGALL
SGWREADRLVSLWDSQVEQSRPRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50015357
n/a
NameBDBM50015357
Synonyms:Buta-2,3-dienyl-[3-(3-buta-2,3-dienylamino-propylamino)-propyl]-amine | CHEMBL287672
TypeSmall organic molecule
Emp. Form.C14H25N3
Mol. Mass.235.3684
SMILESC=C=CCNCCCNCCCNCC=C=C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: