Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(1A) dopamine receptor
LigandBDBM50010295
Substrate/Competitorn/a
Meas. Tech.ChEBML_60185
Ki 5.3±n/a nM
Citation Bakthavachalam VBaindur NMadras BKNeumeyer JL Fluorescent probes for dopamine receptors: synthesis and characterization of fluorescein and 7-nitrobenz-2-oxa-1,3-diazol-4-yl conjugates of D-1 and D-2 receptor ligands. J Med Chem 34:3235-41 (1991) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
D(1A) dopamine receptor
Name:Dopamine D1 and D2 receptor
Synonyms:DA D1 receptor | DOPAMINE D1 | DRD1 | Dopamine D1 receptor | Dopamine D1 receptor (D1R) | Dopamine D1A
Type:Enzyme
Mol. Mass.:49303.43
Organism:Homo sapiens (Human)
Description:P21728
Residue:446
Sequence:
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010295
n/a
NameBDBM50010295
Synonyms:8-Bromo-3-methyl-5-[4-(7-nitro-benzo[1,2,5]oxadiazol-4-ylamino)-phenyl]-2,3,4,5-tetrahydro-1H-benzo[d]azepin-7-ol | CHEMBL322760
TypeSmall organic molecule
Emp. Form.C23H20BrN5O4
Mol. Mass.510.34
SMILESCN1CCc2cc(Br)c(O)cc2C(C1)c1ccc(Nc2ccc([N+]([O-])=O)c3n[o+][n-]c23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: