Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosylhomocysteinase
LigandBDBM50280299
Substrate/Competitorn/a
Meas. Tech.ChEBML_196865
Ki 550±n/a nM
Citation Jarvi ETMcCarthy JRMehdi SMatthews DPEdwards MLPrakash NJBowlin TLSunkara PSBey P 4',5'-unsaturated 5'-halogenated nucleosides. Mechanism-based and competitive inhibitors of S-adenosyl-L-homocysteine hydrolase. J Med Chem 34:647-56 (1991) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenosylhomocysteinase
Name:Adenosylhomocysteinase
Synonyms:Adenosylhomocysteinase | AdoHcyase | CUBP | Liver copper-binding protein | S-adenosyl-L-homocysteine hydrolase
Type:PROTEIN
Mol. Mass.:47687.65
Organism:Mus musculus
Description:ChEMBL_196559
Residue:432
Sequence:
MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPLKGARIAGCLHMTVET
AVLIETLVALGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYLWCIEQTLHF
KDGPLNMILDDGGDLTNLIHTKYPQLLSGIRGISEETTTGVHNLYKMMSNGILKVPAINV
NDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACKEGNIFVTTTGCVDIILGRHFEQMKDDAIVCNIG
HFDVEIDVKWLNENAVEKVNIKPQVDRYWLKNGRRIILLAEGRLVNLGCAMGHPSFVMSN
SFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMP
INGPFKPDHYRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50280299
n/a
NameBDBM50280299
Synonyms:(2R,3R,4S)-2-(6-Amino-purin-9-yl)-5-[1-fluoro-meth-(Z)-ylidene]-tetrahydro-furan-3,4-diol | CHEMBL45769
TypeSmall organic molecule
Emp. Form.C10H10FN5O3
Mol. Mass.267.2165
SMILESNc1ncnc2n(cnc12)[C@@H]1O\C(=C/F)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: