Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 11B1
LigandBDBM8611
Substrate/Competitorn/a
Meas. Tech.ChEMBL_177198
IC50 100000±n/a nM
Citation Browne LJGude CRodriguez HSteele REBhatnager A Fadrozole hydrochloride: a potent, selective, nonsteroidal inhibitor of aromatase for the treatment of estrogen-dependent disease. J Med Chem 34:725-36 (1991) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 11B1
Name:Cytochrome P450 11B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:57478.87
Organism:Rattus norvegicus
Description:ChEMBL_1475489
Residue:499
Sequence:
MALRVTADVWLARPWQCLHRTRALGTTAKVAPKTLKPFEAIPQYSRNKWLKMIQILREQG
QENLHLEMHQAFQELGPIFRHSAGGAQIVSVMLPEDAEKLHQVESILPHRMPLEPWVAHR
ELRGLRRGVFLLNGADWRFNRLQLNPNMLSPKAIQSFVPFVDVVARDFVENLKKRMLENV
HGSMSINIQSNMFNYTMEASHFVISGERLGLTGHDLKPESVTFTHALHSMFKSTTQLMFL
PKSLTRWTSTRVWKEHFDSWDIISEYVTKCIKNVYRELAEGRQQSWSVISEMVAQSTLSM
DAIHANSMELIAGSVDTTAISLVMTLFELARNPDVQQALRQESLAAEASIVANPQKAMSD
LPLLRAALKETLRLYPVGSFVERIVHSDLVLQNYHVPAGTFVIIYLYSMGRNPAVFPRPE
RYMPQRWLERKRSFQHLAFGFGVRQCLGRRLAEVEMLLLLHHMLKTFQVETLRQEDMQMV
FRFLLMPSSSPFLTFRPVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM8611
n/a
NameBDBM8611
Synonyms:4-{5H,6H,7H,8H-imidazo[1,5-a]pyridin-5-yl}benzonitrile | CHEMBL468419 | CHEMBL9298 | Fadrozole | US9271963, Fadrozole
TypeSmall organic molecule
Emp. Form.C14H13N3
Mol. Mass.223.2731
SMILESN#Cc1ccc(cc1)C1CCCc2cncn12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: