Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50000758 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_159122 (CHEMBL878774) |
---|
Ki | 7±n/a nM |
---|
Citation | Thaisrivongs, S; Tomasselli, AG; Moon, JB; Hui, J; McQuade, TJ; Turner, SR; Strohbach, JW; Howe, WJ; Tarpley, WG; Heinrikson, RL Inhibitors of the protease from human immunodeficiency virus: design and modeling of a compound containing a dihydroxyethylene isostere insert with high binding affinity and effective antiviral activity. J Med Chem34:2344-56 (1991) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50000758 |
---|
n/a |
---|
Name | BDBM50000758 |
Synonyms: | CHEMBL48770 |
Type | Small organic molecule |
Emp. Form. | C43H59N7O7 |
Mol. Mass. | 785.9713 |
SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(C)C)[C@@H](O)[C@H](O)[C@H](CC(C)C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)COc1cccc2ccccc12)C(=O)NCc1ccccn1 |
Structure |
|