Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-gated L-type calcium channel alpha-1C subunit
LigandBDBM50002644
Substrate/Competitorn/a
Meas. Tech.ChEBML_164619
IC50 1.4±n/a nM
Citation Sunkel CEFau de Casa-Juana MSantos LGarcía AGArtalejo CRVillarroya MGonzález-Morales MALópez MGCillero JAlonso S Synthesis of 3-[(2,3-dihydro-1,1,3-trioxo-1,2-benzisothiazol-2-yl)alkyl] 1,4-dihydropyridine-3,5-dicarboxylate derivatives as calcium channel modulators. J Med Chem 35:2407-14 (1992) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Voltage-gated L-type calcium channel alpha-1C subunit
Name:L-type calcium channel alpha 1C/beta 2A
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:242793.78
Organism:Oryctolagus cuniculus
Description:ChEMBL_42776
Residue:2171
Sequence:
MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPGGSNYGSPRPAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGVADVPAEDDPSPCALETGHGRQCQNGT
VCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVI
FGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN
RFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAE
MLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKVMSPLGISVLRCVRLLRIFKI
TRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFD
NFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLA
IAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVVGKPALEEAKEEKIELKSIT
ADGESPPTTKINMDDLQPNESEDKSPYPNPETTGEEDEEEPEMPVGPRPRPLSELHLKEK
AVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRN
HILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSA
INVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQL
FKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFT
VSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQ
EQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLIL
LNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLI
VIGSIIDVILSETNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLL
WTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLF
RCATGEAWQDIMLACMPGKKCAPESEPHNSTEGETPCGSSFAVFYFISFYMLCAFLIINL
FVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGF
GKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIK
KIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALS
LQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYY
QSDSRSAFPQTFTTQRPLHISKAGNNQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNA
NNTALGRLPRPAGYPSTVSTVEGHGSPLSPAVRAQEAAWKLSSKRCHSQESQIAMACQEG
ASQDDNYDVRIGEDAECCSEPSLLSTEMLSYQDDENRQLAPPEEEKRDIRLSPKKGFLRS
ASLGRRASFHLECLKRQKNQGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTSLPR
PCATPPATPGSRGWPPQPIPTLRLEGADSSEKLNSSFPSIHCGSWSGENSPCRGDSSAAR
RARPVSLTVPSQAGAQGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDL
TIEEMENAADDILSGGARQSPNGTLLPFVNRRDPGRDRAGQNEQDASGACAPGCGQSEEA
LADRRAGVSSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002644
n/a
NameBDBM50002644
Synonyms:2,6-Dimethyl-4-(2-nitro-phenyl)-1,4-dihydro-pyridine-3,5-dicarboxylic acid 3-isopropyl ester 5-(1,1,3-trioxo-1,3-dihydro-1lambda*6*-benzo[d]isothiazol-2-ylmethyl) ester | CHEMBL78656
TypeSmall organic molecule
Emp. Form.C26H25N3O9S
Mol. Mass.555.556
SMILESCC(C)OC(=[OH+])C1=C(C)N=C(C)C(C1c1ccccc1[N+]([O-])=O)=C([O-])OCN1C(=O)c2ccccc2S1(=O)=O |w:23.25,c:6,t:9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: