| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50001107 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_146261 |
|---|
| Ki | 0.490000±n/a nM |
|---|
| Citation |  Vecchietti, V; Clarke, GD; Colle, R; Dondio, G; Giardina, G; Petrone, G; Sbacchi, M Substituted 1-(aminomethyl)-2-(arylacetyl)-1,2,3,4-tetrahydroisoquinolines: a novel class of very potent antinociceptive agents with varying degrees of selectivity for kappa and mu opioid receptors. J Med Chem35:2970-8 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50001107 |
|---|
| n/a |
|---|
| Name | BDBM50001107 |
|---|
| Synonyms: | 2-(3,4-Dichloro-phenyl)-1-(5-hydroxy-1-pyrrolidin-1-ylmethyl-3,4-dihydro-1H-isoquinolin-2-yl)-ethanone; hydrochloride | CHEMBL554426 | CHEMBL66018 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H24Cl2N2O2 |
|---|
| Mol. Mass. | 419.344 |
|---|
| SMILES | Oc1cccc2C(CN3CCCC3)N(CCc12)C(=O)Cc1ccc(Cl)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
