Reaction Details |
| Report a problem with these data |
Target | Platelet-activating factor receptor |
---|
Ligand | BDBM50002824 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_154987 |
---|
Ki | 2.9±n/a nM |
---|
Citation | Girotra, NN; Biftu, T; Ponpipom, MM; Acton, JJ; Alberts, AW; Bach, TN; Ball, RG; Bugianesi, RL; Parsons, WH; Chabala, JC Development, synthesis, and biological evaluation of (-)-trans-(2S,5S)-2-[3-[(2-oxopropyl)sulfonyl]-4-n-propoxy-5-(3- hydroxypropoxy)-phenyl]-5-(3,4,5-trimethoxyphenyl)tetrahydrofuran, a potent orally active platelet-activating factor (PAF) antagonist and its water-soluble prodrug phosphate ester. J Med Chem35:3474-82 (1992) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Platelet-activating factor receptor |
---|
Name: | Platelet-activating factor receptor |
Synonyms: | PAF Platelet activating factor | PAF-R | PAFR | PTAFR | PTAFR_HUMAN | Platelet activating factor receptor | Platelet-activating factor receptor |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 39219.60 |
Organism: | Homo sapiens (Human) |
Description: | PAF Platelet activating factor PTAFR HUMAN::P25105 |
Residue: | 342 |
Sequence: | MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
|
|
|
BDBM50002824 |
---|
n/a |
---|
Name | BDBM50002824 |
Synonyms: | (S)-5-{3-Methoxy-2-propoxy-5-[(2S,5S)-5-(3,4,5-trimethoxy-phenyl)-tetrahydro-furan-2-yl]-benzenesulfonyl}-4-methyl-pentan-1-ol | CHEMBL334115 |
Type | Small organic molecule |
Emp. Form. | C29H42O9S |
Mol. Mass. | 566.703 |
SMILES | CCCOc1c(OC)cc(cc1S(=O)(=O)C[C@@H](C)CCCO)[C@@H]1CC[C@H](O1)c1cc(OC)c(OC)c(OC)c1 |
Structure |
|