Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50368414 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_157563 |
---|
Ki | 131±n/a nM |
---|
Citation | Rich, DH; Prasad, JV; Sun, CQ; Green, J; Mueller, R; Houseman, K; MacKenzie, D; Malkovsky, M New hydroxyethylamine HIV protease inhibitors that suppress viral replication. J Med Chem35:3803-12 (1992) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50368414 |
---|
n/a |
---|
Name | BDBM50368414 |
Synonyms: | CHEMBL1790867 | CHEMBL3349478 |
Type | Small organic molecule |
Emp. Form. | C45H65I2N7O11 |
Mol. Mass. | 1133.8468 |
SMILES | [H][C@@](O)(CN1CCCC1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)OC)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1c(I)cc(O)cc1I)NC(=O)OC(C)(C)C |
Structure |
|