Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50368429
Substrate/Competitorn/a
Meas. Tech.ChEBML_157563
Ki 0.600000±n/a nM
Citation Rich DHPrasad JVSun CQGreen JMueller RHouseman KMacKenzie DMalkovsky M New hydroxyethylamine HIV protease inhibitors that suppress viral replication. J Med Chem 35:3803-12 (1992) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50368429
n/a
NameBDBM50368429
Synonyms:CHEMBL1790875 | CHEMBL3349486
TypeSmall organic molecule
Emp. Form.C42H68N8O11
Mol. Mass.861.0363
SMILES[H][C@@](O)(CN1CCCC1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)OC)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(C)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: