| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50002209 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_201877 |
|---|
| Ki | 2±n/a nM |
|---|
| Citation |  Gilligan, PJ; Cain, GA; Christos, TE; Cook, L; Drummond, S; Johnson, AL; Kergaye, AA; McElroy, JF; Rohrbach, KW; Schmidt, WK Novel piperidine sigma receptor ligands as potential antipsychotic drugs. J Med Chem35:4344-61 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor, sigma 1 | Oprs1 | SGMR1_MOUSE | Sigma 1-type opioid receptor | Sigma1-receptor | Sigma1R | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25246.51 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | O55242 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPS
TLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS
|
|
|
|---|
| BDBM50002209 |
|---|
| n/a |
|---|
| Name | BDBM50002209 |
|---|
| Synonyms: | 1-(2,2-Dichloro-1-methyl-cyclopropylmethyl)-4-(4-fluoro-phenoxymethyl)-piperidine; compound with but-2-enedioic acid | CHEMBL136615 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H22Cl2FNO |
|---|
| Mol. Mass. | 346.267 |
|---|
| SMILES | CC1(CN2CCC(COc3ccc(F)cc3)CC2)CC1(Cl)Cl |
|---|
| Structure | 
|
|---|
Search and Browse
