Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor
LigandBDBM50005492
Substrate/Competitorn/a
Meas. Tech.ChEBML_139893
IC50 400±n/a nM
Citation Sowell JWTang YValli MJChapman JMUsher LAVaughan CMKosh JW Synthesis and cholinergic properties of bis[[(dimethylamino)methyl]furanyl] analogues of ranitidine. J Med Chem 35:1102-8 (1992) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor
Name:Muscarinic acetylcholine receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:51515.43
Organism:Mus musculus
Description:ChEMBL_139897
Residue:466
Sequence:
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI
VKPNNNNMPGGDGGLEHNKIQNGKAPRDGGTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDDNSRQTCIKIVTKTQKGDACTPTSTTVELVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005492
n/a
NameBDBM50005492
Synonyms:CHEMBL418712 | {5-[9-(5-Dimethylaminomethyl-furan-2-ylmethylsulfanyl)-nonylsulfanylmethyl]-furan-2-ylmethyl}-dimethyl-amine
TypeSmall organic molecule
Emp. Form.C25H42N2O2S2
Mol. Mass.466.743
SMILESCN(C)Cc1ccc(CSCCCCCCCCCSCc2ccc(CN(C)C)o2)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: