| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50005688 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_157548 (CHEMBL763135) |
|---|
| Ki | 0.400000±n/a nM |
|---|
| Citation |  Tam, TF; Carrière, J; MacDonald, D; Castelhano, AL; Pliura, DH; Dewdney, NJ; Thomas, EM; Bach, C; Barnett, J; Chan, H Intriguing structure-activity relations underlie the potent inhibition of HIV protease by norstatine-based peptides. J Med Chem35:1318-20 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50005688 |
|---|
| n/a |
|---|
| Name | BDBM50005688 |
|---|
| Synonyms: | CHEMBL3085518 | N*1*-[1-Benzyl-3-(2-tert-butylcarbamoyl-pyrrolidin-1-yl)-2-hydroxy-3-oxo-propyl]-2-[2-(naphthalen-1-yloxy)-acetylamino]-succinamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H43N5O7 |
|---|
| Mol. Mass. | 645.7452 |
|---|
| SMILES | CC(C)(C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)COc1cccc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
