Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFolylpoly-gamma-glutamate synthetase
LigandBDBM50005860
Substrate/Competitorn/a
Meas. Tech.ChEBML_68543
Ki 115000±n/a nM
Citation Rosowsky AForsch RAReich VEFreisheim JHMoran RG Side chain modified 5-deazafolate and 5-deazatetrahydrofolate analogues as mammalian folylpolyglutamate synthetase and glycinamide ribonucleotide formyltransferase inhibitors: synthesis and in vitro biological evaluation. J Med Chem 35:1578-88 (1992) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Folylpoly-gamma-glutamate synthetase
Name:Folylpoly-gamma-glutamate synthetase
Synonyms:FPGS | Folylpolyglutamate synthase, mitochondrial | Tetrahydrofolate synthase | Tetrahydrofolylpolyglutamate synthase
Type:PROTEIN
Mol. Mass.:64969.76
Organism:Mus musculus
Description:ChEMBL_68680
Residue:587
Sequence:
MSWARSRLCSTLSLAAVSARGATTEGAARRGMSAWPAPQEPGMEYQDAVRTLNTLQTNAS
YLEQVKRQRSDPQAQLEAMEMYLARSGLQVEDLNRLNIIHVTGTKGKGSTCAFTERILRN
YGLKTGFFSSPHMVQVRERIRINGKPISPELFTKHFWCLYNQLEEFKDDSHVSMPSYFRF
LTLMAFHVFLQEKVDLAVVEVGIGGAFDCTNIIRKPVVCGVSSLGIDHTSLLGDTVEKIA
WQKGGIFKPGVPAFTVVQPEGPLAVLRDRAQQIGCPLYLCPPLEALEEVGLPLSLGLEGA
HQRSNAALALQLAHCWLERQDHQDIQELKVSRPSIRWQLPLAPVFRPTPHMRRGLRDTVW
PGRTQILQRGPLTWYLDGAHTTSSVQACVHWYRQSLERSKRTDGGSEVHILLFNSTGDRD
SAALLKLLQPCQFDYAVFCPNVTEVSSIGNADQQNFTVTLDQVLLRCLQHQQHWNGLAEK
QASSNLWSSCGPDPAGPGSLLLAPHPPQPTRTSSLVFSCISHALLWISQGRDPIFQPQSL
PRNLLNHPTANSGASILREAAAIHVLVTGSLHLVGGVLKLLDPSMSQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005860
n/a
NameBDBM50005860
Synonyms:2-{4-[(2-Amino-4-oxo-3,4,5,6,7,8-hexahydro-pyrido[2,3-d]pyrimidin-6-ylmethyl)-amino]-benzoylamino}-4-(ethoxy-hydroxy-phosphoryl)-butyric acid | CHEMBL41459
TypeSmall organic molecule
Emp. Form.C21H29N6O7P
Mol. Mass.508.4647
SMILESCCOP(O)(=O)CCC(NC(=O)c1ccc(NCC2CNc3nc(N)[nH]c(=O)c3C2)cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: