Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin A receptor
LigandBDBM50046131
Substrate/Competitorn/a
Meas. Tech.ChEBML_49724
Ki 520±n/a nM
Citation Corringer PJWeng JHDucos BDurieux CBoudeau PBohme ARoques BP CCK-B agonist or antagonist activities of structurally hindered and peptidase-resistant Boc-CCK4 derivatives. J Med Chem 36:166-72 (1993) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cholecystokinin A receptor
Name:Cholecystokinin A receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:48229.77
Organism:Cavia porcellus
Description:n/a
Residue:430
Sequence:
MDVVDSLFVNGSNITSACELGFENETLFCLDRPRPSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPSLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTGNMCRFLLPNDVMQQTWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFDAIQKKSAKERKTSTGSSGPMEDSDGCYLQKSRHPRKLELRQLSPSSSGSNRINRIRS
SSSTANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAERHLSGTPISFILLL
SYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGTPGVRGEMGEEEEGRTTGASLSRYSY
SHMSTSAPPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50046131
n/a
NameBDBM50046131
Synonyms:CHEMBL297190 | CHEMBL3351059 | N-(1-{[1-tert-Butoxycarbonyl-2-(1H-indol-3-yl)-ethyl]-methyl-carbamoyl}-pentyl)-3-(2-dimethylamino-3-naphthalen-1-yl-propionylamino)-succinamic acid
TypeSmall organic molecule
Emp. Form.C41H53N5O7
Mol. Mass.727.8888
SMILESCCCC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](Cc1cccc2ccccc12)N(C)C)C(=O)N(C)[C@@H](Cc1c[nH]c2ccccc12)C(=O)OC(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: