Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1 (5-HT1) receptor
LigandBDBM50041469
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1137
Ki 0.300000±n/a nM
Citation Zhuang ZPKung MPKung HF Synthesis of (R,S)-trans-8-hydroxy-2-[N-n-propyl-N-(3'-iodo-2'-propenyl)amino]tetral in (trans-8-OH-PIPAT): a new 5-HT1A receptor ligand. J Med Chem 36:3161-5 (1993) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1 (5-HT1) receptor
Name:Serotonin 1 (5-HT1) receptor
Synonyms:5-HT-1A | 5-HT1 | 5-HT1A | 5-Hydroxytryptamine receptor 1A (5-HT1A) | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5HT1A) | G-21 | Serotonin 1a (5-HT1a) receptor/Adrenergic receptor alpha-1 | Serotonin receptor 1A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46445.29
Organism:Rattus norvegicus (rat)
Description:Binding assays were performed using rat hippocampal membranes.
Residue:422
Sequence:
MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT
SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN
SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50041469
n/a
NameBDBM50041469
Synonyms:(R,S) 7-[(3-Iodo-allyl)-propyl-amino]-5,6,7,8-tetrahydro-naphthalen-1-ol | 7-[((E)-3-Iodo-allyl)-propyl-amino]-5,6,7,8-tetrahydro-naphthalen-1-ol | CHEMBL284716
TypeSmall organic molecule
Emp. Form.C16H22INO
Mol. Mass.371.2565
SMILESCCCN(C\C=C\I)C1CCc2cccc(O)c2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: