Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeurokinin 1 receptor
LigandBDBM50000041
Substrate/Competitorn/a
Meas. Tech.ChEMBL_141770
Ki 0.270000±n/a nM
Citation Rosen TSeeger TFMcLean SDesai MCGuarino KJBryce DPratt KHeym JChalabi PMWindels JH Synthesis, in vitro binding profile, and autoradiographic analysis of [3H]-cis-3-[(2-methoxybenzyl)amino]-2-phenylpiperidine, a highly potent and selective nonpeptide substance P receptor antagonist radioligand. J Med Chem 36:3197-201 (1993) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Neurokinin 1 receptor
Name:Neurokinin 1 receptor
Synonyms:Neurokinin NK1
Type:Enzyme Catalytic Domain
Mol. Mass.:46261.42
Organism:GUINEA PIG
Description:Neurokinin NK1 TACR1 GUINEA PIG::P30547
Residue:407
Sequence:
MDNVLPVDSDLFPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAH
KRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPGRVVC
MIEWPSHPDKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAADYEGLEMKSTRYFQTQGSVYKVSRLETTIST
VVGAHEEDPEEGPKATPSSLDLTSNGSSRSNSKTVTESSSFYSNMLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50000041
n/a
NameBDBM50000041
Synonyms:(+) (2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (+)-(2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (+/-)(2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (-) (2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (-)-(2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (2-Methoxy-benzyl)-((1R,4S)-2-phenyl-piperidin-4-yl)-amine | (2-Methoxy-benzyl)-((2S,3S)-2-phenyl-piperidin-3-yl)-amine | (2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (2S,3S)-3-(2-Methoxy-benzyloxy)-2-phenyl-piperidine | (2S,3S)-N-(2-methoxybenzyl)-2-phenylpiperidin-3-amine | CHEMBL2114310 | CHEMBL441225 | CP 99994 | CP-99994 | Tritiated-(2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine
TypeSmall organic molecule
Emp. Form.C19H24N2O
Mol. Mass.296.4067
SMILESCOc1ccccc1CN[C@H]1CCCN[C@H]1c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: