Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM50054067
Substrate/Competitorn/a
Meas. Tech.ChEBML_1317
Ki 3260±n/a nM
Citation Sonesson CBoije MSvensson KEkman ACarlsson ARomero AGMartin IJDuncan JNKing LJWikström H Orally active central dopamine and serotonin receptor ligands: 5-, 6-, 7-, and 8-[[trifluoromethyl)sulfonyl]oxy]-2-(di-n-propylamino)tetralins and the formation of active metabolites in vivo. J Med Chem 36:3409-16 (1993) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Serotonin (5-HT) receptor
Name:Serotonin 1 (5-HT1) receptor
Synonyms:5-HT-1A | 5-HT1 | 5-HT1A | 5-Hydroxytryptamine receptor 1A (5-HT1A) | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5HT1A) | G-21 | Serotonin 1a (5-HT1a) receptor/Adrenergic receptor alpha-1 | Serotonin receptor 1A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46445.29
Organism:Rattus norvegicus (rat)
Description:Binding assays were performed using rat hippocampal membranes.
Residue:422
Sequence:
MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT
SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN
SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50054067
n/a
NameBDBM50054067
Synonyms:(2R)-7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol | (7-Hydroxy-1,2,3,4-tetrahydro-naphthalen-2-yl)-dipropyl-ammonium(R(+)7OH-DPAT) | (R)-7-(dipropylamino)-5,6,7,8-tetrahydronaphthalen-2-ol | (R)-7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol | (R)-7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol.HCl | 7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol | CHEMBL301559
TypeSmall organic molecule
Emp. Form.C16H25NO
Mol. Mass.247.3758
SMILESCCCN(CCC)[C@@H]1CCc2ccc(O)cc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: