Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenergic receptor beta
LigandBDBM50019061
Substrate/Competitorn/a
Meas. Tech.ChEBML_30208
Ki 29000±n/a nM
Citation Chen GTKing MGusovsky FCreveling CRDaly JWChen BHNie JYKirk KL Syntheses of 2,5- and 2,6-difluoronorepinephrine, 2,5-difluoroepinephrine, and 2,6-difluorophenylephrine: effect of disubstitution with fluorine on adrenergic activity. J Med Chem 36:3947-55 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adrenergic receptor beta
Name:Adrenergic receptor beta
Synonyms:Beta-2 adrenergic receptor
Type:PROTEIN
Mol. Mass.:46896.26
Organism:Rattus norvegicus
Description:ChEMBL_38603
Residue:418
Sequence:
MEPHGNDSDFLLAPNGSRAPGHDITQERDEAWVVGMAILMSVIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWNFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHKQ
AIDCYAKETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF
HAQNLSQVEQDGRSGHGLRSSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIRA
NLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSSKTYGNGYSSNSNG
RTDYTGEQSAYQLGQEKENELLCEEAPGMEGFVNCQGTVPSLSIDSQGRNCNTNDSPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50019061
n/a
NameBDBM50019061
Synonyms:(+/-)4-(2-Amino-1-hydroxy-ethyl)-5-fluoro-benzene-1,2-diol | 4-(2-Amino-1-hydroxy-ethyl)-5-fluoro-benzene-1,2-diol | 4-(2-Amino-1-hydroxy-ethyl)-5-fluoro-benzene-1,2-diol(6-FNE) | CHEMBL281232
TypeSmall organic molecule
Emp. Form.C8H10FNO3
Mol. Mass.187.1683
SMILESNCC(O)c1cc(O)c(O)cc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: