Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenergic receptor beta
LigandBDBM50019057
Substrate/Competitorn/a
Meas. Tech.ChEMBL_41763
EC50>1500±n/a nM
Citation Chen GTKing MGusovsky FCreveling CRDaly JWChen BHNie JYKirk KL Syntheses of 2,5- and 2,6-difluoronorepinephrine, 2,5-difluoroepinephrine, and 2,6-difluorophenylephrine: effect of disubstitution with fluorine on adrenergic activity. J Med Chem 36:3947-55 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adrenergic receptor beta
Name:Adrenergic receptor beta
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 39355
Components:This complex has 3 components.
Component 1
Name:Adrenergic receptor beta
Synonyms:ADRB1R, B1AR | Beta-1 adrenergic receptor | Beta-1 adrenoceptor | Beta-1 adrenoreceptor | adrenergic Beta1 | adrenergic Beta1,2
Type:Protein
Mol. Mass.:50486.84
Organism:Rattus norvegicus (Rat)
Description:P18090
Residue:466
Sequence:
MGAGALALGASEPCNLSSAAPLPDGAATAARLLVLASPPASLLPPASEGSAPLSQQWTAG
MGLLLALIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITLPFRYQSLLTRARARALVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLTGPPRPPSPAPSPSPGPPRPADSLANGRSSKRRP
SRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSA
FNPIIYCRSPDFRKAFQRLLCCARRAACRRRAAHGDRPRASGCLARAGPPPSPGAPSDDD
DDDAGATPPARLLEPWAGCNGGTTTVDSDSSLDEPGRQGFSSESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Adrenergic receptor beta
Synonyms:Beta-2 adrenergic receptor
Type:PROTEIN
Mol. Mass.:46896.26
Organism:Rattus norvegicus
Description:ChEMBL_38603
Residue:418
Sequence:
MEPHGNDSDFLLAPNGSRAPGHDITQERDEAWVVGMAILMSVIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWNFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHKQ
AIDCYAKETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF
HAQNLSQVEQDGRSGHGLRSSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIRA
NLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSSKTYGNGYSSNSNG
RTDYTGEQSAYQLGQEKENELLCEEAPGMEGFVNCQGTVPSLSIDSQGRNCNTNDSPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 3
Name:Adrenergic receptor beta
Synonyms:Beta-3 adrenergic receptor
Type:PROTEIN
Mol. Mass.:43161.83
Organism:Rattus norvegicus
Description:ChEMBL_1509452
Residue:400
Sequence:
MAPWPHKNGSLAFWSDAPTLDPSAANTSGLPGVPWAAALAGALLALATVGGNLLVITAIA
RTPRLQTITNVFVTSLATADLVVGLLVMPPGATLALTGHWPLGATGCELWTSVDVLCVTA
SIETLCALAVDRYLAVTNPLRYGTLVTKRRARAAVVLVWIVSATVSFAPIMSQWWRVGAD
AEAQECHSNPRCCSFASNMPYALLSSSVSFYLPLLVMLFVYARVFVVAKRQRRLLRRELG
RFPPEESPRSPSRSPSPATVGTPTASDGVPSCGRRPARLLPLGEHRALRTLGLIMGIFSL
CWLPFFLANVLRALVGPSLVPSGVFIALNWLGYANSAFNPLIYCRSPDFRDAFRRLLCSY
GGRGPEEPRVVTFPASPVASRQNSPLNRFDGYEGERPFPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50019057
n/a
NameBDBM50019057
Synonyms:(+/-)4-Fluoro-5-(1-hydroxy-2-methylamino-ethyl)-benzene-1,2-diol | 4-Fluoro-5-(1-hydroxy-2-methylamino-ethyl)-benzene-1,2-diol | 4-Fluoro-5-(1-hydroxy-2-methylamino-ethyl)-benzene-1,2-diol(6-FEPI) | CHEMBL42359
TypeSmall organic molecule
Emp. Form.C9H12FNO3
Mol. Mass.201.1949
SMILESCNCC(O)c1cc(O)c(O)cc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: