Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenergic receptor alpha-2
LigandBDBM36024
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30085
Ki 390±n/a nM
Citation Chen GTKing MGusovsky FCreveling CRDaly JWChen BHNie JYKirk KL Syntheses of 2,5- and 2,6-difluoronorepinephrine, 2,5-difluoroepinephrine, and 2,6-difluorophenylephrine: effect of disubstitution with fluorine on adrenergic activity. J Med Chem 36:3947-55 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adrenergic receptor alpha-2
Name:Adrenergic receptor alpha-2
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 34061
Components:This complex has 3 components.
Component 1
Name:Adrenergic receptor alpha
Synonyms:Alpha-2C adrenergic receptor | adrenergic Alpha2C
Type:Enzyme Catalytic Domain
Mol. Mass.:49890.50
Organism:RAT
Description:adrenergic Alpha2 0 RAT::P22086
Residue:458
Sequence:
MASPALAAALAAAAAEGPNGSDAGEWGSGGGANASGTDWGPPPGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
VISFPPLVSFYRRPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
TRTLSEKRGPAGPDGASPTTENGLGKAAGENGHCAPPRTEVEPDESSAAERRRRRGALRR
GGRRREGAEGDTGSADGPGPGLAAEQGARTASRSPGPGGRLSRASSRSVEFFLSRRRRAR
SSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQLPEPLFKFFFW
IGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Adrenergic receptor alpha
Synonyms:ADRA2B | Alpha-2B adrenergic receptor | Alpha-2B adrenoceptor | Alpha-2B adrenoreceptor | adrenergic Alpha2B
Type:Enzyme Catalytic Domain
Mol. Mass.:50379.83
Organism:NEONATAL RAT
Description:adrenergic Alpha2B ADRA2B NEONATAL RAT::P19328
Residue:453
Sequence:
MSGPTMDHQEPYSVQATAAIASAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLA
AADILVATLIIPFSLANELLGYWYFWRAWCEVYLALDVLFCTSSIVHLCAISLDRYWAVS
RALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQRPEPRGLPQCELNQEAWYILA
SSIGSFFAPCLIMILVYLRIYVIAKRSHCRGLGAKRGSGEGESKKPQPVAGGVPTSAKVP
TLVSPLSSVGEANGHPKPPREKEEGETPEDPEARALPPTWSALPRSGQGQKKGTSGATAE
EGDEEDEEEVEECEPQTLPASPASVCNPPLQQPQTSRVLATLRGQVLLGKNVGVASGQWW
RRRTQLSREKRFTFVLAVVIGVFVVCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYC
NSSLNPVIYTVFNQDFRRAFRRILCRPWTQTGW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 3
Name:Adrenergic receptor alpha
Synonyms:Adrenaline 2 | Alpha-2A adrenergic receptor | Alpha-2A adrenoceptor | Alpha-2A adrenoreceptor | Alpha-2AAR | Alpha-2D adrenergic receptor | Alpha2 Adrenoreceptor | CA2-47 | adrenergic Alpha2A
Type:G-protein coupled receptor
Mol. Mass.:48961.69
Organism:Rattus norvegicus (rat)
Description:Partially purified membrane from rat cortex was used in assays.
Residue:450
Sequence:
MGSLQPDAGNSSWNGTEAPGGGTRATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGG
QQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDACS
APPGGADRRPNGLGPERGAGTAGAEAEPLPTQLNGAPGEPAPTRPRDGDALDLEESSSSE
HAERPQGPGKPERGPRAKGKTKASQVKPGDSLPRRGPGAAGPGASGSGQGEERAGGAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPYQLFNFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36024
n/a
NameBDBM36024
Synonyms:(R)-(-)-phenylephrine | PHENYLEPHRINE | Phenylephrine,(-)
TypeGuest
Emp. Form.C9H14NO2
Mol. Mass.168.2124
SMILESC[NH2+]C[C@H](O)c1cccc(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: