Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenergic receptor beta
LigandBDBM50042995
Substrate/Competitorn/a
Meas. Tech.ChEBML_30207
Ki 81000±n/a nM
Citation Chen GTKing MGusovsky FCreveling CRDaly JWChen BHNie JYKirk KL Syntheses of 2,5- and 2,6-difluoronorepinephrine, 2,5-difluoroepinephrine, and 2,6-difluorophenylephrine: effect of disubstitution with fluorine on adrenergic activity. J Med Chem 36:3947-55 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adrenergic receptor beta
Name:Adrenergic receptor beta
Synonyms:ADRB1R, B1AR | Beta-1 adrenergic receptor | Beta-1 adrenoceptor | Beta-1 adrenoreceptor | adrenergic Beta1 | adrenergic Beta1,2
Type:Protein
Mol. Mass.:50486.84
Organism:Rattus norvegicus (Rat)
Description:P18090
Residue:466
Sequence:
MGAGALALGASEPCNLSSAAPLPDGAATAARLLVLASPPASLLPPASEGSAPLSQQWTAG
MGLLLALIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITLPFRYQSLLTRARARALVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLTGPPRPPSPAPSPSPGPPRPADSLANGRSSKRRP
SRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSA
FNPIIYCRSPDFRKAFQRLLCCARRAACRRRAAHGDRPRASGCLARAGPPPSPGAPSDDD
DDDAGATPPARLLEPWAGCNGGTTTVDSDSSLDEPGRQGFSSESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50042995
n/a
NameBDBM50042995
Synonyms:2,4-Difluoro-3-(1-hydroxy-2-methylamino-ethyl)-phenol(2,6-DiFPE) | CHEMBL340189
TypeSmall organic molecule
Emp. Form.C9H11F2NO2
Mol. Mass.203.1859
SMILESCNCC(O)c1c(F)ccc(O)c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: