Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosylhomocysteinase
LigandBDBM50051435
Substrate/Competitorn/a
Meas. Tech.ChEMBL_197370
Ki 43±n/a nM
Citation Liu SWnuk SFYuan CRobins MJBorchardt RT Adenosine-5'-carboxaldehyde: a potent inhibitor of S-adenosyl-L-homocysteine hydrolase. J Med Chem 36:883-7 (1993) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenosylhomocysteinase
Name:Adenosylhomocysteinase
Synonyms:Adenosylhomocysteinase
Type:PROTEIN
Mol. Mass.:47537.52
Organism:Rattus norvegicus
Description:ChEMBL_1507790
Residue:432
Sequence:
MADKLPYKVADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPLKGARIAGCLHMTVET
AVLIETLVALGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYLWCIEQTLHF
KDGPLNMILDDGGDLTNLIHTKHPQLLSGIRGISEETTTGVHNLYKMMANGILKVPAINV
NDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACKEGNIFVTTTGCVDIILGRHFEQMKDDAIVCNIG
HFDVEIDVKWLNENAVEKVNIKPQVDRYLLKNGHRIILLAEGRLVNLGCAMGHPSFVMSN
SFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMP
INGPFKPDHYRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50051435
n/a
NameBDBM50051435
Synonyms:5'-Dehydroadenosine | 5'-deoxy-5'-oxoadenosine | 9-beta-D-ribo-pentodialdo-1,4-furanosyl-9H-purin-6-amine | CHEMBL308037
TypeSmall organic molecule
Emp. Form.C10H11N5O4
Mol. Mass.265.2254
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@H](C=O)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: