| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50041669 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_146764 (CHEMBL755208) |
|---|
| IC50 | 18±n/a nM |
|---|
| Citation |  Haaseth, RC; Horan, PJ; Bilsky, EJ; Davis, P; Zalewska, T; Slaninova, J; Yamamura, HI; Weber, SJ; Davis, TP; Porreca, F [L-Ala3]DPDPE: a new enkephalin analog with a unique opioid receptor activity profile. Further evidence of delta-opioid receptor multiplicity. J Med Chem37:1572-7 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40465.04 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50041669 |
|---|
| n/a |
|---|
| Name | BDBM50041669 |
|---|
| Synonyms: | 2-Amino-N-(7-benzyl-4-dihydroxymethyl-3,3,10,14,14-pentamethyl-6,9,12-trioxo-1,2-dithia-5,8,11-triaza-cyclotetradec-13-yl)-3-(4-hydroxy-phenyl)-propionamide | CHEMBL43637 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H43N5O7S2 |
|---|
| Mol. Mass. | 661.832 |
|---|
| SMILES | CC1NC(=O)C(NC(=O)C(N)Cc2ccc(O)cc2)C(C)(C)SSC(C)(C)C(NC(=O)C(Cc2ccccc2)NC1=O)C(O)O |
|---|
| Structure | 
|
|---|
Search and Browse
