Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50028122 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54591 (CHEMBL667314) |
---|
Ki | 560±n/a nM |
---|
Citation | Kotake, Y; Iijima, A; Yoshimatsu, K; Tamai, N; Ozawa, Y; Koyanagi, N; Kitoh, K; Nomura, H Synthesis and antitumor activities of novel 6-5 fused ring heterocycle antifolates: N-[4-[omega-(2-amino-4-substituted-6,7-dihydrocyclopenta [d]pyrimidin-5-yl)alkyl]benzoyl]-L-glutamic acids. J Med Chem37:1616-24 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_MOUSE | Dhfr |
Type: | Enzyme |
Mol. Mass.: | 21608.82 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50028122 |
---|
n/a |
---|
Name | BDBM50028122 |
Synonyms: | 2-Amino-3,7-dihydro-pyrrolo[2,3-d]pyrimidin-4-one | 2-Amino-4a,7-dihydro-pyrrolo[2,3-d]pyrimidin-4-one | 2-Amino-7H-pyrrolo[2,3-d]pyrimidin-4-ol |
Type | Small organic molecule |
Emp. Form. | C6H6N4O |
Mol. Mass. | 150.138 |
SMILES | Nc1nc2[nH]ccc2c(=O)[nH]1 |
Structure |
|