Reaction Details |
| Report a problem with these data |
Target | Adenosine receptor A1 |
---|
Ligand | BDBM50085658 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_28395 (CHEMBL636814) |
---|
EC50 | 8.2±n/a nM |
---|
Citation | Cristalli, G; Volpini, R; Vittori, S; Camaioni, E; Monopoli, A; Conti, A; Dionisotti, S; Zocchi, C; Ongini, E 2-Alkynyl derivatives of adenosine-5'-N-ethyluronamide: selective A2 adenosine receptor agonists with potent inhibitory activity on platelet aggregation. J Med Chem37:1720-6 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A1 |
---|
Name: | Adenosine receptor A1 |
Synonyms: | AA1R_RAT | ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptor | Adenosine receptors A1 | Adora1 |
Type: | Protein |
Mol. Mass.: | 36704.13 |
Organism: | Rattus norvegicus (rat) |
Description: | n/a |
Residue: | 326 |
Sequence: | MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
|
|
|
BDBM50085658 |
---|
n/a |
---|
Name | BDBM50085658 |
Synonyms: | (2R,3R,4S,5R)-2-(2-Chloro-6-cyclopentylamino-purin-9-yl)-5-hydroxymethyl-tetrahydro-furan-3,4-diol | (2R,3R,4S,5R)-2-(2-chloro-6-(cyclopentylamino)-9H-purin-9-yl)-5-(hydroxymethyl)-tetrahydrofuran-3,4-diol | 2-(2-Chloro-6-cyclopentylamino-purin-9-yl)-5-hydroxymethyl-tetrahydro-furan-3,4-diol | 2-(2-Chloro-6-cyclopentylamino-purin-9-yl)-5-hydroxymethyl-tetrahydro-furan-3,4-diol(CCPA) | 2-Cl-CPA | 2-chloro-N6-cyclopentyladenosine | 5-(2-Chloro-6-cyclopentylamino-purin-9-yl)-tetrahydro-furan-2,3,4-triol | CCPA | CHEMBL284969 | N6-Cyclopentyl-2-chloroAdo |
Type | Small organic molecule |
Emp. Form. | C15H20ClN5O4 |
Mol. Mass. | 369.803 |
SMILES | OC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(NC3CCCC3)nc(Cl)nc12 |r| |
Structure |
|