Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThermolysin
LigandBDBM50422014
Substrate/Competitorn/a
Meas. Tech.ChEMBL_210391
Ki 50±n/a nM
Citation Gomez-Monterrey IBeaumont ANemecek PRoques BPFournie-Zaluski MC New thiol inhibitors of neutral endopeptidase EC 3.4.24.11: synthesis and enzyme active-site recognition. J Med Chem 37:1865-73 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Thermolysin
Name:Thermolysin
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:60097.54
Organism:Bacillus thermoproteolyticus
Description:ChEMBL_1468794
Residue:548
Sequence:
MKMKMKLASFGLAAGLAAQVFLPYNALASTEHVTWNQQFQTPQFISGDLLKVNGTSPEEL
VYQYVEKNENKFKFHENAKDTLQLKEKKNDNLGFTFMRFQQTYKGIPVFGAVVTSHVKDG
TLTALSGTLIPNLDTKGSLKSGKKLSEKQARDIAEKDLVANVTKEVPEYEQGKDTEFVVY
VNGDEASLAYVVNLNFLTPEPGNWLYIIDAVDGKILNKFNQLDAAKPGDVKSITGTSTVG
VGRGVLGDQKNINTTYSTYYYLQDNTRGNGIFTYDAKYRTTLPGSLWADADNQFFASYDA
PAVDAHYYAGVTYDYYKNVHNRLSYDGNNAAIRSSVHYSQGYNNAFWNGSQMVYGDGDGQ
TFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEI
GEDVYTPGISGDSLRSMSDPAKYGDPDHYSKRYTGTQDNGGVHINSGIINKAAYLISQGG
THYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQ
AFDAVGVK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50422014
n/a
NameBDBM50422014
Synonyms:CHEMBL319299
TypeSmall organic molecule
Emp. Form.C27H33N3O5
Mol. Mass.479.568
SMILESCC(C)C[C@H](NC(CCc1ccccc1)C(O)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: