| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50038642 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_136087 (CHEMBL745610) |
|---|
| IC50 | 920±n/a nM |
|---|
| Citation |  Portoghese, PS; Ohkawa, S; Moe, ST; Takemori, AE Synthesis and delta-opioid receptor antagonist activity of a naltrindole analogue with a regioisomeric indole moiety. J Med Chem37:1886-8 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50038642 |
|---|
| n/a |
|---|
| Name | BDBM50038642 |
|---|
| Synonyms: | 22-methyl-(2R,13S)-14-oxa-4,22-diazaheptacyclo[13.9.1.01,13.02,21.03,11.05,10.019,25]pentacosa-3(11),5(10),6,8,15,17,19(25)-heptaen-16-ol | CHEMBL291973 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H22N2O2 |
|---|
| Mol. Mass. | 358.433 |
|---|
| SMILES | CN1CC[C@]23[C@@H]4Cc5c([nH]c6ccccc56)[C@H]2[C@H]1Cc1ccc(O)c(O4)c31 |
|---|
| Structure | 
|
|---|
Search and Browse
