Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50038712 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_200981 (CHEMBL801234) |
---|
Ki | 0.65±n/a nM |
---|
Citation | Hudkins, RL; Mailman, RB; DeHaven-Hudkins, DL Novel (4-phenylpiperidinyl)- and (4-phenylpiperazinyl)alkyl-spaced esters of 1-phenylcyclopentanecarboxylic acids as potent sigma-selective compounds. J Med Chem37:1964-70 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50038712 |
---|
n/a |
---|
Name | BDBM50038712 |
Synonyms: | 1-(4-Methoxy-phenyl)-cyclopentanecarboxylic acid 3-(4-phenyl-piperidin-1-yl)-propyl ester; hydrochloride | CHEMBL537464 |
Type | Small organic molecule |
Emp. Form. | C27H35NO3 |
Mol. Mass. | 421.5717 |
SMILES | COc1ccc(cc1)C1(CCCC1)C(=O)OCCCN1CCC(CC1)c1ccccc1 |
Structure |
|