Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50038834
Substrate/Competitorn/a
Meas. Tech.ChEMBL_151699
Ki 1±n/a nM
Citation Sheppard GSPireh DCarrera GMBures MGHeyman HRSteinman DHDavidsen SKPhillips JGGuinn DEMay PD 3-(2-(3-Pyridinyl)thiazolidin-4-oyl)indoles, a novel series of platelet activating factor antagonists. J Med Chem 37:2011-32 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF-R | Platelet-activating factor receptor
Type:Protein
Mol. Mass.:39005.63
Organism:Cavia porcellus
Description:n/a
Residue:342
Sequence:
MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT
VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK
YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG
SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV
FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50038834
n/a
NameBDBM50038834
Synonyms:6-Benzoyl-3-((R)-2-pyridin-3-yl-thiazolidine-4-carbonyl)-indole-1-carboxylic acid dimethylamide | CHEMBL539673
TypeSmall organic molecule
Emp. Form.C27H24N4O3S
Mol. Mass.484.569
SMILESCN(C)C(=O)n1cc(C(=O)[C@@H]2CSC(N2)c2cccnc2)c2ccc(cc12)C(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: