Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50039635
Substrate/Competitorn/a
Meas. Tech.ChEMBL_63980
Ki 0.01±n/a nM
Citation Subramanyam CBell MRCarabateas PCourt JJDority JAFerguson EGordon RHlasta DJKumar VSaindane M 2,6-Disubstituted aryl carboxylic acids, leaving groups"par excellence" for benzisothiazolone inhibitors of human leukocyte elastase. J Med Chem 37:2623-6 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50039635
n/a
NameBDBM50039635
Synonyms:2,6-Dichloro-3-(4-methyl-piperazine-1-sulfonyl)-benzoic acid 4-isopropyl-1,1,3-trioxo-2,3-dihydro-1H-1lambda*6*-benzo[b]thiophen-2-ylmethyl ester; hydrochloride | CHEMBL553298
TypeSmall organic molecule
Emp. Form.C24H26Cl2N2O7S2
Mol. Mass.589.508
SMILESCC(C)c1cccc2c1C(=O)C(COC(=O)c1c(Cl)ccc(c1Cl)S(=O)(=O)N1CCN(C)CC1)S2(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: