| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50368889 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_157711 (CHEMBL763385) |
|---|
| Ki | 45±n/a nM |
|---|
| Citation |  Islam, I; Ng, KY; Chong, KT; McQuade, TJ; Hui, JO; Wilkinson, KF; Rush, BD; Ruwart, MJ; Borchardt, RT; Fisher, JF Evaluation of a vitamin-cloaking strategy for oligopeptide therapeutics: biotinylated HIV-1 protease inhibitors. J Med Chem37:293-304 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50368889 |
|---|
| n/a |
|---|
| Name | BDBM50368889 |
|---|
| Synonyms: | CHEMBL1790790 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H60N6O6S |
|---|
| Mol. Mass. | 716.974 |
|---|
| SMILES | CC[C@@H](C)[C@H](NC(=O)[C@H](C(C)C)[C@@H](O)[C@H](O)[C@H](CC1CCCCC1)NC(=O)CCCC[C@@H]1SCC2NC(=O)N[C@H]12)C(=O)NCc1ccccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
