Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarnitine palmitoyltransferase 2
LigandBDBM50037262
Substrate/Competitorn/a
Meas. Tech.ChEMBL_46324
Ki 2200000±n/a nM
Citation Saeed AMcMillin JBWolkowicz PEBrouillette WJ 3-Amino-5,5-dimethylhexanoic acid. Synthesis, resolution, and effects on carnitine acyltransferases. J Med Chem 37:3247-51 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Carnitine palmitoyltransferase 2
Name:Carnitine palmitoyltransferase 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:74118.53
Organism:Rattus norvegicus
Description:ChEMBL_887443
Residue:658
Sequence:
MMPRLLFRAWPRCPSLVLGAPSRPLSAVSGPDDYLQHSIVPTMHYQDSLPRLPIPKLEDT
MKRYLNAQKPLLDDSQFRRTEALCKNFETGVGKELHAHLLAQDKQNKHTSYISGPWFDMY
LTARDSIVLNFNPFMAFNPDPKSEYNDQLTRATNLTVSAVRFLKTLQAGLLEPEVFHLNP
SKSDTDAFKRLIRFVPPSLSWYGAYLVNAYPLDMSQYFRLFNSTRIPRPNRDELFTDTKA
RHLLVLRKGHFYVFDVLDQDGNIVNPLEIQAHLKYILSDSSPVPEFPVAYLTSENRDVWA
ELRQKLIFDGNEETLKKVDSAVFCLCLDDFPMKDLIHLSHTMLHGDGTNRWFDKSFNLIV
AEDGTAAVHFEHSWGDGVAVLRFFNEVFRDSTQTPAITPQSQPAATNSSASVETLSFNLS
GALKAGITAAKEKFDTTVKTLSIDSIQFQRGGKEFLKKKQLSPDAVAQLAFQMAFLRQYG
QTVATYESCSTAAFKHGRTETIRPASIFTKRCSEAFVRDPSKHSVGELQHMMAECSKYHG
QLTKEAAMGQGFDRHLYALRYLATARGLNLPELYLDPAYQQMNHNILSTSTLNSPAVSLG
GFAPVVPDGFGIAYAVHDDWIGCNVSSYSGRNAREFLHCVQKCLEDIFDALEGKAIKT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50037262
n/a
NameBDBM50037262
Synonyms:(R)-3-Hydroxy-5,5-dimethyl-hexanoic acid anion
TypeSmall organic molecule
Emp. Form.C8H15O3
Mol. Mass.159.2034
SMILESCC(C)(C)C[C@@H](O)CC([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: