Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarnitine acetylase
LigandBDBM50037265
Substrate/Competitorn/a
Meas. Tech.ChEMBL_46180
Ki 25000000±n/a nM
Citation Saeed AMcMillin JBWolkowicz PEBrouillette WJ 3-Amino-5,5-dimethylhexanoic acid. Synthesis, resolution, and effects on carnitine acyltransferases. J Med Chem 37:3247-51 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Carnitine acetylase
Name:Carnitine acetylase
Synonyms:CAT | Carnitine O-acetyltransferase | Carnitine acetyltransferase | CrAT
Type:PROTEIN
Mol. Mass.:70873.46
Organism:Homo sapiens (Human)
Description:ChEMBL_46180
Residue:626
Sequence:
MLAFAARTVVKPLGFLKPFSLMKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSE
EEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSP
GVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSC
RVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSS
LQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVY
RSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIE
YTKKPELVRSPLVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKD
FPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVK
AMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMD
TSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNA
ARLAHYLEKALLDMRALLQSHPRAKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50037265
n/a
NameBDBM50037265
Synonyms:3-Acetylamino-5,5-dimethyl-hexanoic acid anion
TypeSmall organic molecule
Emp. Form.C10H18NO3
Mol. Mass.200.2554
SMILESCC(=O)NC(CC([O-])=O)CC(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: