Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 reverse transcriptase
LigandBDBM50030274
Substrate/Competitorn/a
Meas. Tech.ChEMBL_195669
IC50 940±n/a nM
Citation Okruszek AOlesiak MBalzarini J The synthesis of nucleoside 5'-O-(1,1-dithiotriphosphates). J Med Chem 37:3850-4 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 reverse transcriptase
Name:Human immunodeficiency virus type 1 reverse transcriptase
Synonyms:Reverse transcriptase/RNaseH
Type:PROTEIN
Mol. Mass.:65229.15
Organism:Human immunodeficiency virus 1
Description:ChEMBL_1473730
Residue:566
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLRTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVLFLDGID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50030274
n/a
NameBDBM50030274
Synonyms:1-[4-azido-5'-O-(1,1-Dithiotriphosphate)-methyl-(2R,4R)-dihydro-2-furanyl]-5-methyl-1,2,3,4-tetrahydro-2,4-pyrimidinedione
TypeSmall organic molecule
Emp. Form.C10H12N5O11P3S2
Mol. Mass.535.283
SMILESCc1cn([C@H]2CC(N=[N+]=[N-])C(COP([S-])(=S)OP([O-])(=O)OP([O-])([O-])=O)O2)c(=O)[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: