Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50001709 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_138727 (CHEMBL747749) |
---|
IC50 | 0.500000±n/a nM |
---|
Citation | Nelson, TD; Davis, RD; Nelson, WL Synthesis and opioid receptor affinity of a series of aralkyl ethers of 6 alpha- and 6 beta-naltrexol. J Med Chem37:4270-7 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50001709 |
---|
n/a |
---|
Name | BDBM50001709 |
Synonyms: | 4-cyclopropylmethyl-(13R)-12-oxa-4-azapentacyclo[9.6.1.01,13.05,17.07,18]octadeca-7,9,11(18)-triene-10,14,17-triol | CHEMBL140278 | CHEMBL558140 | Naltrexone-6-beta-ol |
Type | Small organic molecule |
Emp. Form. | C20H25NO4 |
Mol. Mass. | 343.4168 |
SMILES | O[C@@H]1CC[C@@]2(O)[C@H]3Cc4ccc(O)c5O[C@@H]1[C@]2(CCN3CC1CC1)c45 |r| |
Structure |
|